SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351627.Csac_0501 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351627.Csac_0501
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000000000549
Family TTHA0281-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351627.Csac_0501
Sequence length 66
Comment (Caldicellulosiruptor saccharolyticus DSM 8903)
Sequence
MLFTVIVSKEDNWYIAKCVENSVASQGKTIEEAIANLKETLELYYEGEEIQKPQMPPLIT
TIEVAV
Download sequence
Identical sequences A4XGV3
WP_011916085.1.85531 gi|146295558|ref|YP_001179329.1| 351627.Csac_0501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]