SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351627.Csac_2108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351627.Csac_2108
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 3.4e-20
Family TTHA0281-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 351627.Csac_2108
Sequence length 138
Comment (Caldicellulosiruptor saccharolyticus DSM 8903)
Sequence
MKKERYVFPAIFTFDDDGITIEFPDLPGCISCADTLDEAVKNAKEVLGLYLWSMEKDNEQ
IPEPTPVNNLKLEQNQIPMLIEVWMPLVRHEMDNKAVKKTLTIPQWLNMLAEKHNINFSQ
VLQEALKDKLGIKDYKHN
Download sequence
Identical sequences A4XLA6
WP_011917622.1.85531 2005227514 351627.Csac_2108 gi|146297111|ref|YP_001180882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]