SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 351746.Pput_2147 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  351746.Pput_2147
Domain Number 1 Region: 348-550
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 2.88e-26
Family Creatinase/aminopeptidase 0.0029
Further Details:      
 
Domain Number 2 Region: 200-320
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-23
Family Reductases 0.0098
Further Details:      
 
Domain Number 3 Region: 5-93
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-21
Family 2Fe-2S ferredoxin-related 0.048
Further Details:      
 
Domain Number 4 Region: 104-197
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.99e-20
Family Ferredoxin reductase FAD-binding domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 351746.Pput_2147
Sequence length 562
Comment (Pseudomonas putida F1)
Sequence
MQSRHVIEISPTGKTFEASQELLLDAMLASGLPVPFSCRRGACGSCKVKVVSGQHQDKQR
DADTPPPSYPLAADEMLLCQSHACSDMRLEIPGWSLDAPALETQAQVVGKRALSADIVEL
VLQPAQPLEVRAGQYMRFQLDNGDSRCFSIANLPAQAQGQLVFHIRKVSGGLFTEGLLPT
LQAGATVKLEGPLGACTWQHDDQRPLILFATGTGYAGIKPLLLTALAGDADVTLYWGGSS
PADFYDREFLDVSSRVHPHFRWQPVLSAQARIQQVALSQTHRWGETQVYACGNATMISQA
REQCLAAGVQPHRFVAEAFVASGALTTQASSTNPLHPELEKVGPRYSLDGMLAAREQSVR
AVAAIASQLQVGMTTAQALEMAAHTLQAMGASHTWHPTYIRFGDDTVRTPRQGIDLQRVL
RTTDIVVVDVGPVWDGYEGDYGDTFVFGQHALHHACVKALHEVFDETRQAWGRGLTGREL
YDFAERSAQAKGWQLERNLAGHRIADFPHVLYSQDKLAEVEIVPSEVVWVLEIQLCHPTE
PVGAFFEDILIGERKPGAAKAA
Download sequence
Identical sequences A5W2C6
gi|148547368|ref|YP_001267470.1| 351746.Pput_2147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]