SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 355277.LBJ_1867 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  355277.LBJ_1867
Domain Number 1 Region: 260-545
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 8.76e-57
Family DNA repair protein MutS, domain III 0.0000183
Further Details:      
 
Domain Number 2 Region: 555-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.5e-54
Family ABC transporter ATPase domain-like 0.00000145
Further Details:      
 
Domain Number 3 Region: 21-125
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 6.41e-38
Family DNA repair protein MutS, domain I 0.000034
Further Details:      
 
Domain Number 4 Region: 127-272
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.92e-21
Family DNA repair protein MutS, domain II 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 355277.LBJ_1867
Sequence length 848
Comment (Leptospira borgpetersenii serovar Hardjo-bovis JB197)
Sequence
MNLEITGTSAEYWSDLAEALNTPMMKQFLTIKKDFPDTILFFRMGDFYEMFLEDAKIASS
ILDIALTKRQNAVPMCGIPYHSKDNYISRLLNAGKKIAICEQSKPEETGSKLMTRDVVRI
ITPGTVIEENLLTGFQNNYLAVLHLKKSLIYFAMADFSTGELFYSSTPITSLEKLVAELE
KFRPSEICVPQSELSFFQELEYFRDKEFTVLKDQPEIPEKDQFQILSRYLDEYIRETYRD
NKLVLREPRILSSGKFLEMDRETILNLELVENGKEKNHTLYSIFNFCNTAKGKRLLKQRI
LFPECDPMVLYSRWEKQDILFKIVLAPFIAALRDVGDIERILTRFRGNHSYPRDFRSILN
SISTGIKLKKELEALSYPFLIPLEELKVLSEFIEERLHPGDDLPVILGNGPFLKTGFSTR
LDKAREAGFKGKDWILSLEAEEKKRTNLNTLKIRYNKIVGYFIEISRAQAEQAPKDYLKK
QTLVGSERFTTPKLEEIERTILEADEIIQEIERAEFNRMVEEVLKYSSALLSFSEEIGDL
DFQISVLIAKDKFGWIRPELSKDRSLNLVDSRHPVVEATLPPGQEFVPNSVYLDTQNQAI
AVLTGPNMAGKSTFMRQIALNQILFQMGAFVPAKSARLPIVDKLFTRIGAGDNLTAGEST
FYVEMKETANILNHYTEDSLILFDEVGRGTSTYDGMSIAWSILEYLSSLSVKPKTIFATH
YHELTELSRLSGIFNLYLETLEKEDKVLFLRKVKVGKAKKSFGIYVAKIAGIPEPIVKRA
AELLIDLESKKKEIRIQEAQPTLFIEPESKNLPSETEESILKLKLEEMTPMEALKKLEDF
QKKLRKQK
Download sequence
Identical sequences Q04RT2 Q051T9
WP_011670112.1.14 WP_011670112.1.30409 WP_011670112.1.421 WP_011670112.1.48790 WP_011670112.1.51921 WP_011670112.1.55252 WP_011670112.1.75262 WP_011670112.1.87468 WP_011670112.1.95176 355276.LBL_1417 355277.LBJ_1867 gi|116331428|ref|YP_801146.1| gi|116328119|ref|YP_797839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]