SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 357348.BURPS1106A_A1194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  357348.BURPS1106A_A1194
Domain Number 1 Region: 7-81
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.000000000905
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 357348.BURPS1106A_A1194
Sequence length 100
Comment (Burkholderia pseudomallei 1106a)
Sequence
MIAHRRQQASSPLRVSLPVSLGRRWALPALLDVAQRHPLLRLDLSFTDRRSDLVDEGIDR
AVRIGDPRGGSASLACRGLGRRPPGGLAIACRRTVFRNRV
Download sequence
Identical sequences A3P4G9
357348.BURPS1106A_A1194 gi|126457097|ref|YP_001075229.1| gi|403522493|ref|YP_006658062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]