SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_15740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_15740
Domain Number 1 Region: 51-221
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.97e-37
Family B3/B4 domain of PheRS, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_15740
Sequence length 236
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MSRFIVEDDFWSLFPHAKIGIVICQGIDNSSRDVEKYEKLLREAEKEAHKFLRLEEFSSN
PVISVWREAFQKFKTKKGARCSIEALLKRVKNGNPIGTINPLVDIYNSISLRYGFPCGGE
DIDTFVGDIRLTQANGNEPFLPLGQDENASPYEGEIVYKDDEGAICRCWNWREAQRTMLT
ENTKNAFLCMELVDETRIDEFHMALKELSDLVPLHLGGMVKMEVLDIHQKEMTLYS
Download sequence
Identical sequences C0Z981
gi|226311161|ref|YP_002771055.1| WP_012685300.1.45054 358681.BBR47_15740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]