SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 358681.BBR47_16440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  358681.BBR47_16440
Domain Number 1 Region: 291-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-45
Family ABC transporter ATPase domain-like 0.0000718
Further Details:      
 
Domain Number 2 Region: 18-287
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.32e-25
Family DNA repair protein MutS, domain III 0.0082
Further Details:      
 
Domain Number 3 Region: 709-781
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000262
Family Smr domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 358681.BBR47_16440
Sequence length 785
Comment (Brevibacillus brevis NBRC 100599)
Sequence
MEQRVLKTLEYDKIVALLIDKASCTYGKEKASELIPFLRLDEVINAQQGTEQAATVLRLK
GSVPLGGIRDIRGPVQRARLNAMLAPMELLDIASTVMAGRRLKTFLLDMCDDHELPLLQQ
QAERIEGLRELETEIRRCVDENGDILDSASLELRQVRQEIRQLESRIREKLDQMTRSSTY
QKMLMENIVTIRGDRFVIPVKQEYRSVFGGIVHDQSASGATLFIEPEVIVEMNNKLRELR
LREEREVERILYVLTEQVSFAVEALVENTEALTELDFMFAKAQLAWSMKAICPRINDRGY
VNMRKARHPLIPREVVVPVDVELGGEYQAIVVTGPNTGGKTVSLKTIGLLSLMTMAGLHI
PAEEESEMTVFSSIFADIGDEQSIEQSLSTFSSHMTNIIQILAKMDDKSLVLFDELGAGT
DPTEGAALAMSIIDHVIDSGARLVATTHYSELKAYAYDRPEVINASVEFDVQTLRPTYRL
LIGVPGRSNAFAIARRLGLPEHIIDVARGSISEEDNQVESMIASLERNRKSAEADRLAAK
AARQEAEELRTQLEEERAQFAEEKNKRMERAEDEARIAVQLAKEEAETIIRELREMMAEG
MEIKEHRLIDAKKRLGNAVLELEKEKVKKPAKAVRATQIKVGDEVMVTSFGQKGTVLEKV
NNEEFLVQIGIMKMKVKRDDMHVQNSIQQKPQAAPYTSVKRRSDNIKMDLDLRGYNVEDS
IREIDQFLDDALLAGLHSVSIIHGHGTGVLRKGVHEYLRSHRNVKSFRLGGQGEGGVGAT
IAELK
Download sequence
Identical sequences C0Z9F1
358681.BBR47_16440 gi|226311231|ref|YP_002771125.1| WP_012685367.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]