SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362242.MUL_3282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362242.MUL_3282
Domain Number 1 Region: 38-140
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 362242.MUL_3282
Sequence length 146
Comment (Mycobacterium ulcerans Agy99)
Sequence
MSVDIAEPFTPHPMLSIRLLRELGDPHSTLRAATDFRSTAVLIHAGGEVDAANEHTWRQL
IAETAASAPSPGLFVVDVSGLDFMGCCAFEVLAEQAGRCRARGVELRIASAAHTRVTRIV
AACGLSDALPVYRSVDAALALPAPSD
Download sequence
Identical sequences A0PT12 L7V2T1
362242.MUL_3282 WP_011741090.1.20315 WP_011741090.1.39490 WP_011741090.1.5386 gi|118618620|ref|YP_906952.1| gi|443490471|ref|YP_007368618.1| MyulA.17065.a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]