SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 362976.HQ2653A from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  362976.HQ2653A
Domain Number 1 Region: 1010-1175
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.28e-56
Family DNA gyrase/MutL, second domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 117-237,565-609
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.44e-27
Family Intein (protein splicing domain) 0.014
Further Details:      
 
Domain Number 3 Region: 27-111
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-18
Family DNA gyrase/MutL, N-terminal domain 0.0038
Further Details:      
 
Domain Number 4 Region: 607-718
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000113
Family DNA gyrase/MutL, N-terminal domain 0.0063
Further Details:      
 
Weak hits

Sequence:  362976.HQ2653A
Domain Number - Region: 740-785
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.093
Family Topoisomerase VI-B subunit middle domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 362976.HQ2653A
Sequence length 1304
Comment (Haloquadratum walsbyi)
Sequence
MTSFQSTLGEEGEIADELAESQRAISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDNALD
ATEEAGIKPDISIEIRESGDYYTLIVEDNGPGITREQVPKVFGKLLYGSRFHAREQSLTP
TQTLLIRRDGDVTFTSIGDFCDSYLPADGPASAPIPVDANIEVPSFDRATHEMTWQPVTN
AIRHRTDERVYRISTACGRTLEITGNHSLFSLSSDNETIEVNAGELSPGDSILAPKQLPM
ASESVDTSTTVDEKTQSSTGAQTQRINILEHIKPDDLKESAATFRIHEADQASLSSGGNH
KSPSASLASSQLASSEVIASAGGQQIQSSADQRQSKGHTPGGDHHNNECLLIKSVCENDK
MSTVADYTLEIVTPDGESSRLPVSVSIDNVFITSLVRYIATASTSDISPVSDSSVDYTTE
ERHNTVDRSFSDTMRPLDSVIPLICEDDGEIELPSFVFESDPKRQQQLLTQLYRYPEASN
GRNAGDDTVTYTTTSATLARQLTTLWNMNGVVATTNTQTETSQSDEIENESAQTTIYEVS
VDRAEIETDIAGSDSDCQQGDGDLCLVSVSSVEEIDAPPYVYDISVPGASGHDENFVTAN
DGAICVKNSRGQQGIGISAAVLYSQLTSGKPARITTRTQSSDTAQYFELIIDTDTNEPEV
SADQERDPGAASLSPTHGTRIELEMEANMRARGQLRDYVKDTAVVNPHARITLDEPGLEE
PRQYERVDGAELPAQTEEIRPHPHGVELGTLLKMLEATESYSVSGFLREEFTRVGSKTAT
KILDQFRDRHFGRALPMSAPETIPDNADGTDDEQVTSSLESIIEAAVVNKGASATTTFAS
RVAETVNQRSGTTQGELVGIVDTVAEDIEDEFETTFGTTVRENAVEAAWDVLTTDIDEDI
YPLVADATSTQKDHETVRGVTDRIATKFADGSEPLRATRDAVREYVDRSADMIVSEEVSF
GETARENVVDAVWTAMQTVDDELPAVKAVADDRNIASDLLEAMRLTDILAPPTDCLSPIT
ADLVEAGLRKEFDADFYAAATRDAEVHGGDPFIVEAGIAYGGELEGGKISLLRFANRVPL
VYQRGACATTDVIKSIGWRNYGLDQPGGSGMPNGPAVVMIHVASTNVPFTSESKDALANI
PAIEDEIELAVREASRELKSYLNKRRSMQKRREKQDVLGRILPEMANKLADVTENDRPDI
DNALARIMNNVSVERNVDNGSVTLTVQNYSDRQESPTLTDIVDSKPDTIPDEIEIVELED
EYFLTWEPVVDAGESATVTYEVPTGASFELDVDDVETEKLTIDA
Download sequence
Identical sequences Q18GY1
362976.HQ2653A gi|110668559|ref|YP_658370.1| WP_011571880.1.31310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]