SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 363253.LI1098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  363253.LI1098
Domain Number 1 Region: 247-575
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.19e-81
Family beta-Lactamase/D-ala carboxypeptidase 0.00011
Further Details:      
 
Domain Number 2 Region: 82-229
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.57e-40
Family Penicillin binding protein dimerisation domain 0.002
Further Details:      
 
Domain Number 3 Region: 630-679
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 363253.LI1098
Sequence length 693
Comment (Lawsonia intracellularis PHE MN1-00)
Sequence
MSYLGLSHRQNKYHKFTWTTSRKKVRGKYFSFRIDKWNAFRFQIVAILFCIVWCGLWCRS
AYIQLWKGTFFSEKARRQHIALETVSTPRGNIVDRNGRILAKSIQCYSVYADPFSIKDIE
STAIKLSNCLHLSEETIRKLLQKQNRFVWISRHIDDATAIAINQMKIPGVMLLKEYERVY
PYKHVAGQLLGFVGVDGNGLEGLEHSFNDYLSSFSTKQLVMRDASGRRFYINNGEELHNS
TRELQLTIDLQIQSIAEDAIAQAVSEVGAKWGGVLIVDVKSSEILAWSQYPFFNPNAYRQ
YKPSEYRNRLALDAFEPGSTFKPFLIAAALQEGIVTKDTLFNCEGGVWKIKNVVIRDDGT
PQKELSVTKILSHSSNIGCGKISLELGSQKFYYYLTKLGFGQPTGLNIIENKGILRRPRE
WSEADLISTAFGQSLSTNALQLTQGFLTIATHGIYKPISLFKTPLKKVSEQRIFSEDISS
EVLTMMRQVVESGTGKRAAISGVSIAGKTGTAQKVDKTGKYGQERIASFVGLFPAEDPHY
LIMVVIDEPITKKYGGVIAAPVFRKIATKVMAYVGSPESLQYQVVTKEEEKISSNKVSSL
VRTNKKEKSCSNTLEVRQKIDRKDPIEYATSLKIPDVVGKSIRKAIELFAGQGLVPEVKG
NGIVVIKQEPEAGTHLIKQHLLDKKCILWVSEK
Download sequence
Identical sequences A0A1S8BR71 Q1MPC5
363253.LI1098 WP_011527181.1.40060 WP_011527181.1.91582 WP_011527181.1.98040 gi|442556394|ref|YP_007366219.1| gi|94987540|ref|YP_595473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]