SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 365044.Pnap_3575 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  365044.Pnap_3575
Domain Number 1 Region: 9-191
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.45e-54
Family Methylesterase CheB, C-terminal domain 0.00011
Further Details:      
 
Weak hits

Sequence:  365044.Pnap_3575
Domain Number - Region: 226-264
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0318
Family Cytochrome c3-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 365044.Pnap_3575
Sequence length 341
Comment (Polaromonas naphthalenivorans CJ2)
Sequence
MENSQLPNRDIVVIGASAGGVEALRGFFAALPADLDAAILVVLHIPADTPSQLDQVLANA
TPLPVVIAEDGQPIEHGRVYVASADRHLMVTPQGIRLSRGPKEVRARPSVDVLFRSAAAA
FGSRVIGVVLSGALDDGTAGLWAIKDHQGATLVQIPSQAMHPSMPESAIAHVQVDFVGTV
EALADKVRELVGTAAPVVAASALSLQRAMENDIAMQGNALKAGIMNLGKVSPYTCPDCHG
VLMQIEEGTIVRFRCHTGHAFSLKTLMAEINDAIDQSLWATLRAVEERVMLLRQMEQLAL
HSGANDTAAQWRKQADDSEQRLQPLRDLVLDPGFFGHASKN
Download sequence
Identical sequences A1VT93
365044.Pnap_3575 WP_011802941.1.22642 gi|121606463|ref|YP_983792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]