SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00001561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00001561
Domain Number 1 Region: 5-254
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.1e-87
Family Capz beta-1 subunit 0.0000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00001561
Sequence length 266
Comment (Neosartorya fischeri)
Sequence
MADIQFDSALDLLRRLNPRDTKQNLQAITSIVPDLTEDLLSSVDQPLEIRRCPKTNRDYL
LCDYNRDGDSYRSPWSNEFDPPLEDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVILLKKGVTPGAKSSGEWDSIHVFEATDRARMSHYKLTSTVILHLANENE
ALGEMDLSGNMTRQMEVDLPVESDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDVVGE
LRSLAPLSETNKEKAAHLEMIRSMQR
Download sequence
Identical sequences A0A0J5PQ79 A0A229WGP5 A0A229YZA0 A0A2I1BWB9 A1D4V4
36630.CADNFIAP00001561 NFIA_021560||f-actin XP_001265344.1.95823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]