SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00002412 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00002412
Domain Number 1 Region: 11-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000455
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 2 Region: 71-113
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000087
Family Zn2/Cys6 DNA-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00002412
Sequence length 398
Comment (Neosartorya fischeri)
Sequence
MPRPRKLLDMRCTTCQTSFNRREHYQRHLRSHTEEKPFSCVYCQQIFSRGDSLARHYTSV
HQTDTGKPLAKRRRVIKACESCRLSKVRCDGKEPCQRCCDQHRECSYLVSKRTGQSATRT
GQLPRGHCLNLPSRQDQAGSQPTNTSLSINVVSQAYPQSQKLYEQAPVHSPAQADAAYGA
IDTITVPPFFSLDWNDFDEWLNFGFDDEYMGLSAPAASATAAITGLYGNIQEPDMDKDAI
DPRQYYPASIELDAQLVFPDMATIASEDIEKENLALVEQVPDGTPRKVFEMATVLQTKSN
YPKFIELRIPPARVLNAWVQLYFEHFHPVFPILHKPTFCPARMNPFLVLTVAAIGAHFSD
LEGSQACYKAMHELIRRYTSYTVRLHLKTTSVSSNTVG
Download sequence
Identical sequences A1DCW2
36630.CADNFIAP00002412 XP_001261569.1.95823 NFIA_027460||C2H2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]