SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00003962 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00003962
Domain Number 1 Region: 64-99
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000445
Family Zn2/Cys6 DNA-binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 11-39
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000766
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00003962
Sequence length 384
Comment (Neosartorya fischeri)
Sequence
MPPQPLSCSSPPPFQCDHPGCGAKYRRKEHLNRHVASHSRGDCFSCPDLLRRHIRIYHPD
RAPPASRAQKACAACHARKERCYGGFPCSACQKRGIACSPGKGESQEEHIVDNNVQISQQ
PHPPRWIALDYVDIYFDNFHPKWPFLHQGTFDVTKEPCVLIQSVIMIGLWIEGSKKSRDA
ATDLHRSLSTAIRTQMDRWRVSNQNQSTSWPMATYQSVLLQCIFALFLAGERAAIDLNLR
YRIQDDEYDLLVTLVESCRLGGIFSYPNMLAQHSSAAPLTLVWLSIEEIKRFGLALYKVC
RLSTRLEPTGADGSSAKSELLTLADLSFGMPDSDEAWNSISGVGSEARQEVAVQTNLRDS
QDPTGWISQSSSVLSNARVAFDWI
Download sequence
Identical sequences A1CV44
36630.CADNFIAP00003962 XP_001267518.1.95823 NFIA_044400||predicted

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]