SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00007422 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00007422
Domain Number 1 Region: 73-109
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000000955
Family Zn2/Cys6 DNA-binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 8-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000295
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00007422
Sequence length 382
Comment (Neosartorya fischeri)
Sequence
MKTAASVNEGPFRCPQRECSRSYRRKEHLTRHSASHSQAPACECPFCDKVFSRTDTLRQH
VRALHKDKELESSRTVIACSYCRSRKTRCDGTAPCESCSGRGLQCSLSRQGNPQNAGTMR
VDCIYVEIYFKEFHPVWPFLHRATFEPSQEPPILLQSVVMMGLWTTGNVEMQCHAVKLHD
KLSSLVYEQRDNWAATNSESEVQSPWPMATYQAILLQIIFAFLKDTHSQVDIRLARTIPT
SCCSRLLTTLTDTCVRKNMFFYPEILARFSRDSVPDVFIWVGIEEVKRFALALYKVCRSC
HIQCKNGPRNLHGNQRGRSLLTLADLRFSLPDSDELWNATSDLAARLAEDGPLYYDNINA
ETNWISQSVRLLQRPDMTFDWL
Download sequence
Identical sequences A1DDQ6
NFIA_074330||C2H2 XP_001259410.1.95823 36630.CADNFIAP00007422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]