SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00008168 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00008168
Domain Number 1 Region: 35-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000871
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 98-141
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000089
Family Zn2/Cys6 DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00008168
Sequence length 1047
Comment (Neosartorya fischeri)
Sequence
MVELANRREAETGADETSINRAREVRLGSAPGQTKCSICHSTFRRPEHLKRHFRSHTKEK
PFECAQCGRHFSRTDTLHRHELSHHTLGPEGGKDRMHRITVKTFRACYKCAVARVRCSGG
SPCVRCENRSLECQYPTERRSKAKTRKEVAQNLSSDGNSTICGQATQHESPSSTAGDDVH
GADIREQSRNEPPRFQITEFQLDLPGSHCLDTPSKDMPAEKPHGPPGGESSEHQNGPPED
ETADLNSRMLLSDAGGSTHDARVSLPEYAGLSSQHFYSQLPAGGAQTFSQESTSQLDHRS
RDIQQTVAATPNLNLELAGVGGQQMQLGFDPPFLDQSMLSTLNWLPNDMFPDTTSDQSLS
RMPPLSDQLGILDEPVSRTAWLPPVTNLRQMSPSVRENHSHTPSGHMSVGTDAGSPDRFS
RSIGEGSLHSEPSNATKRSGDFYVDGAGARLPKYRRSRTSWSRLSAEPIEILAPMHQHDT
LHQFSFPLIQDIRPDFLPGEEAASNCRIEAPTYDKIYHSFLRLCRTDNPLYPKFETGNFP
SADALSSYVYLYYDSFQPVYPLFHPPTFNPNSCHWLVTLAISAVGCRFSGLTPLDEFTTA
FDEFLRRAINIEAMTLNCIGLLHSSGNEQSKVSTLNAFGDLVNFTIREGLLCAVNKPTAQ
YGDLPLEQKWHDWVEDEIRRRTGYLIWLLDCSLAYYFDNRPLLSLDDGQCPLPSHENLWE
AHSAEAWRDVLERTSDLRGISLYNAVLTIYIEKKLVPEIGEFSHVLLIHALYHRMWEVGD
YFRRPLSFWNPTAKKQSLDTAIPSGSVWLPGIPSYSKWRNSACDCLDILHWTANSTIAKA
AGLEHPTVLHLHAARIVLLAPFREIRSLATSLAMGKIRWSDHQQALEWHYILRWIKHDQY
KARLAIIHAGTTLWHVRRYSTNAFHEPVAVYLSILTLWAYGSCHVQIAKDPSSRYGPRHH
PVREPTFIHLDRPCDDELVQLFVREGHVMQGNVTGVGDICAPHGPERILNVGCETLAGLT
SWGISKRFIAILTKLAELSSQPQAPRN
Download sequence
Identical sequences A1DDY7
XP_001259491.1.95823 NFIA_075230||C2H2 36630.CADNFIAP00008168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]