SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 36630.CADNFIAP00010409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  36630.CADNFIAP00010409
Domain Number 1 Region: 23-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000145
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 2 Region: 91-130
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000107
Family Zn2/Cys6 DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 36630.CADNFIAP00010409
Sequence length 884
Comment (Neosartorya fischeri)
Sequence
MATDSPLPILDNSPHSSLAGQRDGYFQCGSCEKRYNRADHLIRHVRTHTREKPYVCDVCN
KGFARPDLMKRHAAGHIHPRDSKRRRLSSYPKNGRVSQACKTCAASKLKCDDEKPCRRCQ
EKNLVCHWAQGVSSIDASPQSQHQACQSDQAPHLPVDAAQVRTTFSSPIDGQINHYPNQM
VSPNAQMNNYLPVGLQSGLPTMDRDSGVFSVDGTFFPDFIPDSLIPSLTRTSDLDPLPVL
PQDSIHSVFDHNVDFDFDLTDMDYGLIDLFNSRGAVHHNAHNSDGANEHGDADSGIAIGA
EAYHRSSLSAWKPAHEDHAFADQENLSVPETIDSPEANFRPDRQMVSERLSPSGRDLIFG
LVLQTSQRANLTRIMKSFPSTQLLDSLIQYYFESQSHDIDSWIHGPTFRMNDEAPDMLAA
LAAAGAARSTIPTIRRLGYALMEIVRLQMSVKYESDNSTTRDLRASQTFALTIDVGIWSG
NARRTEIAESFQQPLVTMMRRGLRFRRSVYSNIAPSPDDDGEILEKKWRDWAHSESFNRL
VHHMFLHDAQSAMMLNVNPIISYSELELPLPAPRSLWEAKSAKDWKEAYLASGLSSRGRT
PSLVDTLQDMSQLSAFQSQIDLQLSTLAVIHGLCTLISEYHRHKFIAKGHSKHWSALVIS
SRHQELSQALQHLRMLCFEMSSALGPGIVLVFELISMFLHMSLEELQLFAGKEDKNEARR
VYQSALEWIGSIDSRRAIWHAGQVIRAAKVMPPGSLTGFFALGVYYASLAFWSYSVVSKA
KDSQAVVVSPPSDPHFRGPWPTVYLDGEETTDVQRFISLGCGCPALQTPSGAAVITDPGQ
IMDAIQGRLQGDAHHDNLPPLVQGLCQLMCDLGNAARSKTYVST
Download sequence
Identical sequences A1D8U1
XP_001262699.1.95823 36630.CADNFIAP00010409 NFIA_113320||C2H2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]