SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_0278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_0278
Domain Number 1 Region: 6-350
Classification Level Classification E-value
Superfamily Phase 1 flagellin 8.76e-25
Family Phase 1 flagellin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_0278
Sequence length 350
Comment (Sinorhizobium medicae WSM419)
Sequence
MKTSFVSNLAVQNAMRLTIQQGQAELLKLQTEVTTGRHADVGLALGSSTARSVSLQRELA
RLGTLVDTNSVVTQRLAASQSALAAMAEAAQQVRNTLVTFKGNDAADQLAIQNTEIQSAI
SAFSSAANLSFNGEFLFAGINTDVRPFNDYSAAGSTAKTTFDNALATYMSANGIASMSDF
TKAQMEDFITNTLEPLYASDAQWAADWSDASSQNMTSRISTTEVVQSSANATTEGFRKFA
LASVIALELMDENVSSEVRAYIGEAALGYVEQANTQITAERSTLGISEARVKKANTSLQA
QIKLIKTHITDLEGVDTYEASTRMNTLLTQVETSYTLTSRIQRLSLIDFL
Download sequence
Identical sequences A6U657
gi|150395505|ref|YP_001325972.1| 366394.Smed_0278 WP_011974488.1.29075 WP_011974488.1.7720 YP_001325972.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]