SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_0394 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_0394
Domain Number 1 Region: 19-228
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.8e-69
Family FAD-linked oxidases, N-terminal domain 0.0051
Further Details:      
 
Domain Number 2 Region: 234-472
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 9.97e-64
Family Cytokinin dehydrogenase 1 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_0394
Sequence length 479
Comment (Sinorhizobium medicae WSM419)
Sequence
MPETIGFLKPRQAVLDRRREIVADLGDLLPEGCLISDERGLKPFETDAFIAYRRMPLAVV
LPETTEQVATVLKYCSRYGIPIVPRGAGTSLSGGAIPQEDAIVVGLSKMARILDIDLFNR
TATVQAGVTNLNISDAVSADGFFYAPDPSSQLACTIGGNIGMNSGGAHCLKYGVTTNNLL
GVKMVLFDGTVIELGGKALDASGYDLLGLICGSEGQLGIVTEATVRLIAKAEGARPVLFG
FATSESAGSCVADIIGSGIIPVAIEFMDKPAIEICEAFAHAGYPLDVEALLIVEVEGSEA
EMDSMLAGIIGIARRHGVMTIKESQSALEAALIWKGRKSAFGATGRIADYICMDGTVPLS
QLSHVLRRTGEIVAGYGLRVANVFHAGDGNMHPLILYNINDPDEAARAEEAGNDILKLCV
EAGGCLTGEHGVGIEKRDLMLFQYSKADLDQQMGARAAFDPQWLLNPSKVFPLEGRPAA
Download sequence
Identical sequences A6U6H1
WP_011974599.1.29075 WP_011974599.1.61285 WP_011974599.1.7720 WP_011974599.1.89664 YP_001326086.1.44884 gi|150395619|ref|YP_001326086.1| 366394.Smed_0394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]