SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_2563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_2563
Domain Number 1 Region: 207-352
Classification Level Classification E-value
Superfamily CBS-domain pair 6.96e-33
Family CBS-domain pair 0.0032
Further Details:      
 
Domain Number 2 Region: 349-430
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.55e-20
Family CorC/HlyC domain-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_2563
Sequence length 434
Comment (Sinorhizobium medicae WSM419)
Sequence
MTDVILAFLADYWLSLLSVICLLVISAFFSGSETALTAASRSRMHTLENNGDERAGIVNN
LIERRDRLIGTLLIGNNLVNILASSLTTSLLIGLFGDSGVAIATVAMTVLLVIFSEVLPK
SWAIASPDRFALAVAPLVRPFVVVVGPISSLVNAIVRRILHLFGVNLSSDLPMLSAHEEL
RGAVNLLHREGSVIKADRDRLGGVLDLGELEVSDIMIHRTSMRAINADDPPETCVREILE
SPFTRLPLWRGSADNIIGVVHSKDLLRALAEPNVEPETLDIVKIAQKPWFVPDSTNLKDQ
LNAFLRRKLHLAIVVDEYGQVQGLVTLEDILEEIVGDIADEHDIDIQGVRQEADGSIVVD
GSVPIRDLNRALDWSLPDEEATTVAGLVIHESKSIPEERQAFTFYGKRFTVMKRVKNRIT
KLRIRAAEDEGQVG
Download sequence
Identical sequences A6UCL3
366394.Smed_2563 WP_012066784.1.29075 WP_012066784.1.61285 WP_012066784.1.7720 YP_001328228.1.44884 gi|150397761|ref|YP_001328228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]