SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_3073 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_3073
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.89e-48
Family TAP-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_3073
Sequence length 213
Comment (Sinorhizobium medicae WSM419)
Sequence
MALKDFLPFLFGLTMTIVLSAAARAEPVSLVGFGDSLMAGYQLPPEDAFPTRLEKALKGK
GIDVTIANAGVSGDTTSGGLARIDWSVPEGTDGVILELGANDALRGIPPEETRKNLEAMI
VRLKKRGIAVLLAGMMAPPNMGPDYGERFNAIYPELAKEHDTVFYPFFLDGVVTEAGLKL
EDGMHPNGEGIAVMVDRFLPTAETFIRTLQEGE
Download sequence
Identical sequences A6UE19
366394.Smed_3073 gi|150398267|ref|YP_001328734.1| WP_012067280.1.29075 WP_012067280.1.31871 WP_012067280.1.61285 WP_012067280.1.7720 WP_012067280.1.89664 YP_001328734.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]