SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_3220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_3220
Domain Number 1 Region: 406-572,737-802
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 3.66e-85
Family Type II DNA topoisomerase 0.00051
Further Details:      
 
Domain Number 2 Region: 15-221
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-70
Family DNA gyrase/MutL, N-terminal domain 0.000000329
Further Details:      
 
Domain Number 3 Region: 233-403
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-59
Family DNA gyrase/MutL, second domain 0.000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_3220
Sequence length 811
Comment (Sinorhizobium medicae WSM419)
Sequence
MTEISETEAGAIAEYGADSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVYEVVDNAIDE
ALAGHADLVTVTLNPDGSVTVTDNGRGIPTDIHREEGVSAAEVIMTQLHAGGKFDQNSYK
VSGGLHGVGVSVVNALSVSLKLKIRRSGKIHEMSFTHGVADGPLKVTGDAGSDTGTEVTF
TPSEQTFSNIEFEFARLEHRLRELAFLNSGVRIVLTDKRHSDIRREELMYDGGLEAFVAY
LDRAKKPLVQKPVSIRGEKDGITVEVAMWWNDSYHENMLCFTNNIPQRDGGTHMAGFRAA
LTRQITSYADSSGVTKKEKVSLTGDDCREGLTAVLSVKVPDPKFSSQTKDKLVSSEVRPV
VESLVNEALGVWLEEHPSDAKILVGKVVEAAAAREAARKARELTRRKGALDISSLPGKLA
DCSERDPAKSELFLVEGDSAGGSAKQGRSRESQAILPLRGKILNVERARFDKMLSSQEIG
TLITALGTSIGPDEFNADKLRYHKIIIMTDADVDGAHIRTLLLTFFFRQMPVLIERGHLY
IAQPPLYKVARGKSVQYLKDEKALEDYLINMGLEEASLELASGEVRAGQDLREVINDALR
LRSLMDGLHSRYNRSVVEQAAIAGALNVELNGQRNEYQQIAAEVARRLDVIAEETERGWA
AEVTAEGGLKLERMVRGVKEAAVLDMALIGSSDARHIDQLKSRLKEVYGAPPMLRRRDGT
QEISGPRALLDAIFAAGRKGLTMQRYKGLGEMNAEQLWETTLDPNVRSLLQVKVNDATDA
DGLFSRLMGDEVEPRRDFIQENALSVANLDI
Download sequence
Identical sequences A6UEG4
366394.Smed_3220 WP_012067425.1.29075 WP_012067425.1.31871 WP_012067425.1.7720 WP_012067425.1.89664 YP_001328879.1.44884 gi|150398412|ref|YP_001328879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]