SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_3263 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_3263
Domain Number 1 Region: 94-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-33
Family Imidazole glycerol phosphate dehydratase 0.00018
Further Details:      
 
Domain Number 2 Region: 8-92
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.64e-32
Family Imidazole glycerol phosphate dehydratase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_3263
Sequence length 202
Comment (Sinorhizobium medicae WSM419)
Sequence
MADVTPSRTGQVSRKTNETAVSVALDVEGTGSSKIVTGVGFFDHMLDQLSRHSLIDMDIK
AEGDLHVDDHHTVEDTGIAIGQALAKALGDRRGITRYASIDLAMDETMTRAAVDVSGRPF
LVWNVAFTAPKIGTFDTELVREFFQALAQHAGITLHVQNIYGANNHHIAETCFKSVARVL
RTATEIDPRQAGRVPSTKGTLA
Download sequence
Identical sequences A6UEK7
366394.Smed_3263 WP_012067468.1.7720 YP_001328922.1.44884 gi|150398455|ref|YP_001328922.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]