SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_3478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_3478
Domain Number 1 Region: 67-128
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.02e-16
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 130-187
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-16
Family Cold shock DNA-binding domain-like 0.0033
Further Details:      
 
Domain Number 3 Region: 6-65
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000217
Family eIF5a N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_3478
Sequence length 189
Comment (Sinorhizobium medicae WSM419)
Sequence
MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRISDGVKVSERYRTTE
QVERAFVEDREHTFLYEDGEGFHFMNPETYDQLVMSTEDIGDLKAYLQEGMAVMLSIHEG
LAIAIDLPRHVTLEIVETEPVVKGQTASSSYKPAVLSNGVRTLVPPHIQAGTRVVIATED
GSYVERAKD
Download sequence
Identical sequences A6UF66
366394.Smed_3478 gi|150398664|ref|YP_001329131.1| WP_012067676.1.29075 WP_012067676.1.61285 WP_012067676.1.7720 WP_012067676.1.89664 YP_001329131.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]