SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_4499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_4499
Domain Number 1 Region: 191-373
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.14e-54
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000153
Further Details:      
 
Domain Number 2 Region: 378-485
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 6.15e-33
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0000986
Further Details:      
 
Domain Number 3 Region: 105-176
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.2e-32
Family CO dehydrogenase ISP C-domain like 0.00016
Further Details:      
 
Domain Number 4 Region: 7-97
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.28e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_4499
Sequence length 496
Comment (Sinorhizobium medicae WSM419)
Sequence
MEQAPDSIRFILNDTEIALSDVAPTATLLDYLRLERRLTGTKEGCAEGDCGACTVLVGRL
AHDGEGGETTLVYESVNACIRFMGSLNATHIVTVEHLAGKDGKLHPVQQALVDFHGSQCG
FCTPGIVMSLYGLWLTNDRPGRAAIEKALQGNLCRCTGYEPIVRAAEAAAADRPDVLFDP
ITRVREAVRARLQELRQAERIEIRSGVDCLIVPADAADLARVLADRPAATIVAGCTDVGL
WVTKQMRPLNTVVFVNGIAELQRIESSKAGLTIGAGVSYSAAYEALSSAYPSFGRLLDRV
GGDQVRNMGTIGGNIANGSPIGDSPPPLIVLGATLTLRSHGGSRTLPLEDFFIAYGKQDR
RPGEFVESIFVPALPAGERFAAYKISKRRDEDISALLGAFRISLDGDRVKAARIAFGGMA
ATPKRAKVVEAALLGELWNEGTIRDAQSAFDTDYQPITDWRATGAYRLLAAKNLLMRFFL
ESTGETAQLRRFEEVA
Download sequence
Identical sequences A6UI19
gi|150376636|ref|YP_001313232.1| gi|150376636|ref|YP_001313232.1|NC_009620 366394.Smed_4499 WP_012061432.1.29075 WP_012061432.1.61285 WP_012061432.1.7720 YP_001313232.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]