SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 366394.Smed_6260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  366394.Smed_6260
Domain Number 1 Region: 235-292,322-494
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000654
Family DeoB catalytic domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 366394.Smed_6260
Sequence length 553
Comment (Sinorhizobium medicae WSM419)
Sequence
MKRIVLLLSPLVILLSPIIDAFQGVYIDPRSDAGYAVIACVAIIGLALGMIATFCYKRGA
VGNVVTAGTLAVTLFLFGDLSYGVFWRLADHIGMGGAAALAFAGLVVLILVLFKLMAAVP
RMMAAFAVALLGSTVLDRGLITEASAEESAPAVIYIVTDEMIGISGIDTRLPHGAEAKAA
LSRVFQKHGFRLHSKAFSRHILTQVSVPAALNMDYSYNFPGDRSHYAYPGEVTKFKELSL
FNLWHRQGLSVNVFQSAHLDYCKTEALVDCHTFASFDGSRFIQRQRIEGGPYRDVPPASA
SLADVKALIEGNRQSLAMAAVGFVASNLLETKETALQEWHPRSYDQLAFPYWLGQFQNMI
LDKGRGNAFFAHFLFPHSPSVYNKDCKPTNRWVERSYLTEVRGLAGQELDEARVKEYGFY
FAQTLCLAKQLDKFFNAVLSDKRFQDATIVVHGDHGSRISAGRNVETMSPRDYVDNYSAL
YAVRKPGVATGTDYRLHSVQWLNASLFRGNVSEVAPTVVGSMQSKSDDSALYAPITDPDH
VAIMPMHDFDASH
Download sequence
Identical sequences A6UMH9
366394.Smed_6260 gi|150378197|ref|YP_001314792.1|NC_009621 gi|150378197|ref|YP_001314792.1| YP_001314792.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]