SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 367928.BAD_0442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  367928.BAD_0442
Domain Number 1 Region: 4-299
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.83e-41
Family N5-glutamine methyltransferase, HemK 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 367928.BAD_0442
Sequence length 306
Comment (Bifidobacterium adolescentis ATCC 15703)
Sequence
MATVFETVRSAADELRAAGVDTPQHDAKLLLAEAFHTDLQHVDKAMLMGDGVERLAEKED
AEPAMERFQTMLARRVKREPLQHITGHAPFRYLDLKVGPGVFIPRPETELVVQEGVDWAT
RNGMYRAKVVDLCAGSGAIGLAFASEVPGSEVWAVEKSATTAEWTWRNLDETAKRYPAIA
GNYHLDIADATQMPTLSQLDGTIDIVLTNPPYVPLADIPEQSEVRDYDPDLALYGGSADG
TLIPERIIARAAKLLRAGGLMVMEHDITQGERLAAFARTCGFVDVTVHNDYTGRPRYLTA
EKQPAQ
Download sequence
Identical sequences A1A0J0
367928.BAD_0442 gi|119025460|ref|YP_909305.1| WP_011742904.1.36503 WP_011742904.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]