SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 367928.BAD_1109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  367928.BAD_1109
Domain Number 1 Region: 8-120,221-314
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.35e-36
Family MraW-like putative methyltransferases 0.00052
Further Details:      
 
Domain Number 2 Region: 121-221
Classification Level Classification E-value
Superfamily Putative methyltransferase TM0872, insert domain 3.01e-32
Family Putative methyltransferase TM0872, insert domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 367928.BAD_1109
Sequence length 343
Comment (Bifidobacterium adolescentis ATCC 15703)
Sequence
MTDVTTIHQPVLLRDCVDLVAPALAKPGSIAVDCTLGLAGHSTAFLKASPNARLIGIDRD
TEALALATKRMEMEGLADRFTPVHAAFDDFSQVLSDQGVDKVNAVFMDLGLSSLQIDETE
RGFSYSHDAPLDMRMDVTQPLTAEQVLAEYSFADLVRIFRAYGEERFSKQIAREIVRRRE
TEPLTTSGQLNRLVDEVVPQAHRPAGNPAKRVFQALRIEVNGELDKLAGTLPQIANHLAV
GGRLVVESYHSLEDKTVKAFMNQGLKVDAPADMPVVPPDMMPFFKELTRGAIKADAEEIA
NNPRSASVRLRAVELTRPIPARWRKRFDQGADYASMTRQGRRD
Download sequence
Identical sequences A0A1X2ZCW2 A1A2F7
WP_011743449.1.36503 WP_011743449.1.55335 WP_011743449.1.64668 367928.BAD_1109 2004009955 gi|119026127|ref|YP_909972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]