SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.estExt_Genewise1_v1.C_400705 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.estExt_Genewise1_v1.C_400705
Domain Number 1 Region: 106-194
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-18
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.estExt_Genewise1_v1.C_400705
Sequence length 201
Comment (Populus trichocarpa)
Sequence
MAAKVTAYEESRRKRMEENKKRMEALNLHKLSRALKISTPTKSSPMKRSKPRVVEKQVVV
VRRSNRCDTVLLRISKARDLSNRVYATDEARAKAMEKAEKLQSDLGSDYPIFIKSMLQSH
VTGGFWLGCLPLDFCRRNLPRRDDFITLIDEEADEYQVIYLARKNGLSGGWKGFAVAHGL
LDGDAVVFQLIKPTACKYISG
Download sequence
Identical sequences 3694.estExt_Genewise1_v1.C_400705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]