SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.00880041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.00880041
Domain Number 1 Region: 120-187
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000141
Family B3 DNA binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.00880041
Sequence length 269
Comment (Populus trichocarpa)
Sequence
MMMHQGMVHEKPEACAWMAGGEGVTEEGDNKQTPNIEGGSDLVIDGSNRDHLAGSMVGLE
IKRKKRMPRQRRSSSTINHLLSFSANVSCSTTTTLDVPTFSLQDPSSLPARAIDPRRLRF
LFQKELKNSDVSSLRRIILPKKAAEAHLPALESKEGIFIRMDDLDGLHAWSFKYRYWPNN
NSRMYVLENTARNAVNDFVVHDYEVSKLSSFYVNYPVVDNTGLSFIYDTTAFSNDSPLDF
LGGSMTNFSRIGNLESFGSVENLFLDDFY
Download sequence
Identical sequences A0A2K1X3Z6
3694.eugene3.00880041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]