SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.01070018 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.01070018
Domain Number 1 Region: 147-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000216
Family B3 DNA binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.01070018
Sequence length 279
Comment (Populus trichocarpa)
Sequence
MEKEDTKLMKLEKMDKDDYPEELREQGAAALLLSCLLHTRLSCKTALALDKVKSNILGGG
KRNQNSHSSRRRPRVSPTQNPGAAVRRNHFDDQQGEGNSNAAARNLPGEPPIRSLEVALR
LIENYDPHEVPSIPGLNGIIGRCSKPFEKQLTESDLRDDQSRLSINKADAQKYLYPLLNE
DENLAEGINVTTYDPNGKEFEMVFKIWVSKIHVLIGGWKAFFHEHQLRKDQDFVTLWMFR
RLDTEKLCFVINWRRLPGVTTPIKRKRVRMNKSMDQLTC
Download sequence
Identical sequences B9N1E3
3694.eugene3.01070018 XP_006370221.1.11743 POPTR_0001s40760.1|PACid:18236504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]