SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.eugene3.17130003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.eugene3.17130003
Domain Number 1 Region: 142-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000112
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3694.eugene3.17130003
Sequence length 269
Comment (Populus trichocarpa)
Sequence
MEKQQQFCVLSPCFPSRNTNNPKKRKECECQQAEREVFAGSQPIFNEHPFWFKKPKTSSG
IGSIVVASRNPGRVLKEPKLFDESWVFKNSVDPDSRNNESGEELERRVAFNLRTMRSSFS
LGDLLEERSRGVSTQLSLYHHDPFEIKKKMKPSDLGNLCRLLVSADLVEKHILPFLNEDQ
TKQVIIPNQEINGLKVWVWDIDTGSMHQLVFKRWSTSKSYIFNDGWTKHFVKRRNLRESD
EIGLYWDNDQSRFHFSVLSRAAAVAKIRN
Download sequence
Identical sequences B9NHC1
POPTR_0003s19090.1|PACid:18217101 3694.eugene3.17130003 XP_006385973.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]