SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3694.gw1.IX.2134.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3694.gw1.IX.2134.1
Domain Number 1 Region: 117-209
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-23
Family B3 DNA binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3694.gw1.IX.2134.1
Sequence length 211
Comment (Populus trichocarpa)
Sequence
MAKSKQTYEEIRQKRVEENKKRMEELNLTKLSQSLLSKPSPLKKGKPRTFRPAAALTPVR
RSTRVSDRPTVSYKEVRDAMFDFWANMQRDLLNRVYASDEVRIYAIHRADQIQSSLGADF
PSFVKPMLQSHVTGGFWLGLPVPFCKAHLPHYDEMITLEDENGDESETKYLAGKTGLSGG
WRGFAIDHDLVDGDALVFQLVSPTKFKVRLL
Download sequence
Identical sequences 3694.gw1.IX.2134.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]