SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G05920.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G05920.1-P
Domain Number 1 Region: 179-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-17
Family B3 DNA binding domain 0.0061
Further Details:      
 
Weak hits

Sequence:  3702.AT1G05920.1-P
Domain Number - Region: 142-177
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 0.0785
Family Methylenetetrahydrofolate reductase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G05920.1-P
Sequence length 315
Comment (Arabidopsis thaliana)
Sequence
MSSRDKPKTFAEVREEICKRREEMISRDNQKKTKTVAQVREEKGKRREEMISRYNQKKAK
TVAQVKEGKGKRREEMISRDNRTKPKTVAQVRDAKRKRTFDHVPRGTREPHAYLRNDPAP
QVASVPKSVPEEKDVILDRILSNVPRRKKTTSYEFVPPKHPQEPQWLLQVMSRMNGAGDP
KLIIEKNLDSNDVDPRQNRLSIPINTVIQNDFLTLDESRLIDEDEITNEGNMGVAAFLVD
QRTKKWNMGFKQWFMTTDSGSSYWSFVLRGEWSNVVETNGLKEGDKISLWSFRSNDILCF
ALVPPTSSVVESLDK
Download sequence
Identical sequences Q5RM09
NP_172083.1.80155 AT1G05920.1 AT1G05920.1 3702.AT1G05920.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]