SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G05930.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G05930.1-P
Domain Number 1 Region: 178-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000196
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G05930.1-P
Sequence length 318
Comment (Arabidopsis thaliana)
Sequence
MTTNDDDHAAERNTMSMNYELAATLSDEEQRARKGKAKIVCKEEDHVFIKKKEKYEEESE
KREFFSHVPRKIRPALRYPQPNFENPNGASSSLNLPFEEDYYMAEYYKKTETINPPNPYH
QWSPSSFLTEYTHPRMLEVLHRCGFNRPVVTCYSRTAREMRWWLRQVMKDMRAEDLTLIL
EKTLSTTDVITTTHGRFSMHFNRLISNDFLKPEERSILEEDTYNDETMGVGAILVDQRSQ
KWSVILKRWGQNYFLSCGWNDVVKANKLKAGDDICLWAFRCDGVLCFAMRQWRGILCFAL
VPPLTLRQSSSSNARRLC
Download sequence
Identical sequences Q9MA32
AT1G05930.1 3702.AT1G05930.1-P NP_172084.2.80155 AT1G05930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]