SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT1G67220.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT1G67220.1-P
Domain Number 1 Region: 1276-1360
Classification Level Classification E-value
Superfamily TAZ domain 8.89e-17
Family TAZ domain 0.00065
Further Details:      
 
Domain Number 2 Region: 1075-1147
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000188
Family ZZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 721-765
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000696
Family PHD domain 0.014
Further Details:      
 
Domain Number 4 Region: 1197-1265
Classification Level Classification E-value
Superfamily RING/U-box 0.00000118
Family ZZ domain 0.012
Further Details:      
 
Weak hits

Sequence:  3702.AT1G67220.1-P
Domain Number - Region: 644-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00738
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT1G67220.1-P
Sequence length 1367
Comment (Arabidopsis thaliana)
Sequence
MAPPRKRTRDLMPKFLNTESFDEFNQRLNNLPAESNVTSDEDAQFLESRKCQSKRWRKEE
PLKLNLRSPWNVLCSPESISSAKFIVEKTCLIPVPSFEEAATNARRCLNTSSIPGSSGSA
SETNSGSDITKQDFKNDSPSDSKKVQGSSTSKSAKPKVIKVYSFVDLVTTTKKGNIQTEE
SSLNHEKKLGTVVDIVEPMKCDERSKEVQGSSTSKSAKPKVIKVYSFADVVTTTKKGNIQ
TEESSLNHEKKLGTVVDIIEPMKCDERSKEVQGSSTSKSAKLKVIKVYSFADVVTTTKKG
NIQTEESSLNHEKKLGTVVDIVEPMKCDERSKEVQGSSTSKSEKPKVIKVYSFADVVTTT
KKGNIQTEESSLNHEKKLGTVVDIVEPMKCDEGTKCEVTTTNKGKIHTEERSLNHEKKLG
TVVDIVEPMKCDEGSKCEVTTTNKGNTQTEERSLNHEKKLGIGVDIVEPMKCDEGTKCEV
TTTNKGKIQTEERSLNYEKKLGIGVDIVEPMKCDEENKCEVNADTFDVVIVEPMKCNKVT
KCEVNVDTTGVNIVEPMKCNEVTKCEVNVDTIGVDIVEPMKCNEESKCEVNADTMSLQKR
SKRAVSLVERFTEEEIKLHIMSLKKPSTQSAVEGMCDLKEEEESCQLCDDGTLLFPPQPL
YCLLCSRRIDDRSFYYTPGEEELSNAQHQICSPCHSRCKTKFPLCGVFIDKHKMLKRSNF
DNADTEEWVQCESCEKWQHQICGLYNKLKDEDKTAEYICPTCLLEECQSINNMALVDYTD
SGAKDLPETVLSYFLEQRLFKRLKEERYQTAKATGKSINDVPEPEGLTLRVVFSADRTLT
VNKQFASLLHKENFPSEFPYRSKVILLFQKVHGVDICIFALFVQEFGSECSQPNQRSTYI
FYLDSVKYFKPERVTFAGEALRTFVYHEVLIGYLEYCKLRGFTTSYIWACPPKIGQDYIM
YSHPKTQQTPDTKKLRKWYVSMLQKAAEQRVVMNVTNLYDRFFDSTEEYMTAARLPYFEG
SFWSNRAEIMIQDIEREGNNELQKKVKLLSRRKVKTMSYKTTGDVDVDDVKNILLMEKLE
KEVFPNKKDLMVVELNYSCTRCSKAVLSGLRWFCEKCKNLHLCESCYDAGQELPGEHIYK
RMDKEKHQLSKVQVNGVLFSTTEDNDIIQENDMFESRQAFLAFSQKHNYNFHTLRHAKHS
SMMILHHLHTSNKHHCSQNSSSLTCTACKKDVSTTIYFPCLLCPDYRACTGCYTKNRTLR
HLHIFPTLPSANRAPSRTVMVLEILNAISHALLCQHKTTKSCSYPKCHEVKALFTHNVQC
KIRKKGTRCNTCYKLWQTIRIHVYHCQDLNCPVPQCRDRKEVLIRKV
Download sequence
Identical sequences Q9FYH1
NP_564891.4.80155 3702.AT1G67220.1-P AT1G67220.1 AT1G67220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]