SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT2G06025.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT2G06025.1-P
Domain Number 1 Region: 204-281
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.97e-18
Family N-acetyl transferase, NAT 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT2G06025.1-P
Sequence length 288
Comment (Arabidopsis thaliana)
Sequence
MSTISIHRTETLRITHARSRIFRQRYRRTIPLWKLTINSRSSDTSKKEELSVQISIPPQV
DQSRPEGLRFDRLQPPEPEFGHEDRFEFGKFVAREAMLDEEYWTAAWLRAESHWEDRSNE
RYVDNYKRKFAEQEFNAIKRRCKGMQGQKCSCIVAVKKEEKHIKRSVIKSVVGTLDLSIR
YFLQGETFPGEKVKSQLFCSINQEGSNRYGYIANLCVAKSARRQGIACNMLRFAVESARL
SGVEQVYVHVHKNNSVAQELYQKTGFKIVETGKFESLDDDTYLLQYTS
Download sequence
Identical sequences Q8GUT5
3702.AT2G06025.1-P NP_001318205.1.80155 NP_001324281.1.80155 NP_671784.2.80155 AT2G06025.1 AT2G06025.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]