SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT2G33720.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT2G33720.1-P
Domain Number 1 Region: 201-312
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000159
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT2G33720.1-P
Sequence length 326
Comment (Arabidopsis thaliana)
Sequence
MKMPPPFSASKTQYLFHDESSENSKKSLVSTTLSLSSCENPNKRKMNSDEVLNISCIPRD
YKLTQVERKIARMRNLSYQEKAEDEWYGVSTELTLFKDPWIIKKVFHFASVLDMAPNSVS
NTHCLLDTESPENAEESLVSLDLCFYDKTWPHDPNVAYNKPTSEEAINLAWMRTMSKRAR
KEEEKYYVSTELTLLTVADPWTLKMAMTKSSIGNLYRLVLKASFVDIHILRYLPLDDQMM
VKEDSGLAVEVYDHDTDSVHNLALKKWAKSSSFVLVSGWRKCFVDRRGLQVGDVIGMYWD
RSESKLHFCVLSRSETMDSAPLPPSP
Download sequence
Identical sequences O23659
NP_180928.1.80155 AT2G33720.1 AT2G33720.1 3702.AT2G33720.1-P AR854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]