SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G24850.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT3G24850.1-P
Domain Number 1 Region: 226-349
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.45e-16
Family B3 DNA binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G24850.1-P
Sequence length 359
Comment (Arabidopsis thaliana)
Sequence
MSSMYHDYDHLTASGKGLWSKFYGLVDAAVLLYDEIQRRGKIVSEEESQKRIFCLFPRRK
RSSLVKRQQKLNGGFISFTSSSLIDLNQLPTDSEIEDPQTSDSQMKTLQNSSSEPCTSLV
LFDYKTAESEKMEAKTLQNPSSELCSSLVLSDYKMAESEKMETKDPPNPLSLCLTGNTSR
KRRAVEERKRTGGFKKAKVAPFPGTARDTPKWLVKVMRDMKEAKDAKLIFEKTLFVTDIN
PTQNRLSMPFNNLLQNDFLTSVESRIIKEDINNNKKIGVGAILVDQRSVKWGVMLKRWEL
KKESGKGSWNYNLICGWNDVVEANGLKEGDNISVWSFRCRGVLCFAMEQSSSSLALCLC
Download sequence
Identical sequences Q9LRX6
3702.AT3G24850.1-P AT3G24850.1 AT3G24850.1 NP_189129.1.80155 GO.12457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]