SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT3G60520.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3702.AT3G60520.1-P
Domain Number - Region: 5-59
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000594
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT3G60520.1-P
Sequence length 129
Comment (Arabidopsis thaliana)
Sequence
MVDLERRVCCMCGDVGFFDKLFHCSKCLNRFQHSYCSSYYKEQADPIKICDWCQCEAKSR
TGAKHGVNGGSSKRSYRSEYSSPHHQIKQQEINQTTSSSIPPAADKGKTGVPSPRPATRR
YKLLKDVMC
Download sequence
Identical sequences A0A178V606 Q9M207
3702.AT3G60520.1-P AT3G60520.1 AT3G60520.1 NP_191611.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]