SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT4G03160.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT4G03160.1-P
Domain Number 1 Region: 69-169
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000294
Family B3 DNA binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT4G03160.1-P
Sequence length 192
Comment (Arabidopsis thaliana)
Sequence
MDDVTPDELEAVSVLLRLPNPVFFDQEEEEEDEEEEYDEESVCEDDLEVKSCMQTNENKG
KKRKVAEQLMDSDVKDNQYRLMLGKEPVKKMMDALGKTEKLGTKGLNVSVYGPNGENHKM
VLKIWIKGTPVLTSGWKNFVKSYKLEKHVDFLTIWMFRHKKTREICFAIDSTRFPVKGTL
SKRILQEVFKNP
Download sequence
Identical sequences Q9ZR15
AT4G03160.1 3702.AT4G03160.1-P NP_192225.1.80155 AT4G03160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]