SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT5G24050.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT5G24050.1-P
Domain Number 1 Region: 216-339
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.55e-17
Family B3 DNA binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3702.AT5G24050.1-P
Sequence length 349
Comment (Arabidopsis thaliana)
Sequence
MTSIYHDDDDHLTASGKDLWSNFCVLVDAAVMLYEEEEEEQRRKIVSEEEEEFQKRIFCL
FPRKTRSSLVKRQQNLIRVSTSSSLIDLNQFPTDSEIEDPQNHLQGLSSSCFIAANSETK
TLQNPSSEPCSSLGLFGHKTAEYQKTETKDPPNPNFPCTMSLCLMENTSRKRRAVEQRKR
SGGVKKANVAPFSQTARETPEWLVKVMTNMKEAKDAKLIFEKTLFVTDVNPTKNRLSMPF
NNLLRNDFLTSVESIIINEDINNNNKIGVGAILVDQRCKKWGVMLKRWEMKKESGKGSWS
YNLICGWNDIVEANRLKEGDNITLWSFRCCGILCFAMEQSSSSLALCLC
Download sequence
Identical sequences A0A178UBN6 Q9FLV7
NP_197793.1.80155 3702.AT5G24050.1-P AT5G24050.1 AT5G24050.1 GO.24232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]