SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3702.AT5G61100.1-P from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3702.AT5G61100.1-P
Domain Number 1 Region: 32-81
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000421
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3702.AT5G61100.1-P
Sequence length 227
Comment (Arabidopsis thaliana)
Sequence
MVYESGNKPGPENPTFSSDLSLSDSLVKLKKKPCEVCGSDANELLMMTCFMCRDTREHTY
CARVMFQRVPRLWICEECRDFSSVANKTANAQSSRTIQVEQVVVKQVRIDQTVPSPRTNQ
VVDNHQDPPIDQTDPSSTTIQVVDNENLIEAAPSSRSNQVVDNKDWIEAAPSLRSNQVVP
VAPRIHEFTTDESSSPVSPLFKSMWERFPVKRPSHYIDLSSDSESEE
Download sequence
Identical sequences F4K1Z8
3702.AT5G61100.1-P AT5G61100.1 AT5G61100.1 NP_200918.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]