SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 374847.Kcr_1354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374847.Kcr_1354
Domain Number 1 Region: 4-433
Classification Level Classification E-value
Superfamily L-aspartase-like 7.38e-108
Family L-aspartase/fumarase 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 374847.Kcr_1354
Sequence length 456
Comment (Candidatus Korarchaeum cryptofilum OPF8)
Sequence
MWVHPIDSRYGSELMRAIFRQENRIKLMARVEALYARALAERGFIPKEAAEAIERAAEEV
TPEDVRAEEALVKHETMALVRAISKRAGRYGEYLHLGLTSNDVLDTVMGVQIRQAGSIIL
RSSASLLEKIVKRGEESLDIVCLGRTHGVVADPIPLSMKFALWSYYVRRSIARFMDSLNE
ASVGKLRGAVGTAAASIELGIKDPLEVESEVLAALGLSPPEITTQVVPRDRLAHLILSMS
LFSSALDTIANEIRNLHRTEISEVKEHFEERQVGSSTMPHKMNPINSEKVCGLARLMRSL
AIAALENVVLEHERDLTNSSVERAILPEAFLILEEQINTLSAVIENLEIDRVRIGENLEK
YGDIALSERLMIWLVKKGLGRQEAHEIVRSISLRSHRSGRRFIDEVLADESLSKILRPEE
IEAIFSPRSYLGLGRELSIEEFRAAREFLKEVLLNG
Download sequence
Identical sequences B1L6M1
WP_012309997.1.97847 gi|170290967|ref|YP_001737783.1| 374847.Kcr_1354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]