SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 374931.CGSHiGG_00725 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  374931.CGSHiGG_00725
Domain Number 1 Region: 5-198,370-577,615-647
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.32e-139
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000685
Further Details:      
 
Domain Number 2 Region: 648-902
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.76e-68
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000322
Further Details:      
 
Domain Number 3 Region: 196-371
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.96e-61
Family ValRS/IleRS/LeuRS editing domain 0.0000277
Further Details:      
 
Domain Number 4 Region: 887-951
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.99e-17
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 374931.CGSHiGG_00725
Sequence length 954
Comment (Haemophilus influenzae PittGG)
Sequence
MTQKFEMADRFNPSAVEQALYQHWEESGYFKPSENENAPSYCIAIPPPNVTGSLHMGHAF
QQTLMDTLIRFNRMEGHNTLWQAGTDHAGIATQMVVERKIAAEEGKTRHDYGREAFINKI
WDWKAYSGGTISQQMRRLGNSIDWERERFTMDDGLSNAVKEVFVRLHEEGLIYRGKRLVN
WDPKLHTAISDLEVENKESKGSLWHFRYPLANDAKTADGKDYLVVATTRPETMLGDTAVA
VHPEDERYQSLIGKTVILPLANREIPIIADEYVDREFGTGVVKITPAHDFNDYEVGKRHN
LPMVNVLTLNANIRDEAEIIGTDGKPLAGYEATIPADYRGLERFAARKKIVADFEALGLL
DEIKPHDLKVPYGDRGGVPIEPMLTDQWYVSVKPLADVAIKAVEDGEIQFVPKQYENLYF
SWMRDIQDWCISRQLWWGHRIPAWYDAEGNVYVARNEEEVRSKYNLDSAVELKQDEDVLD
TWFSSGLWTFSTLGWPEQTKELKMFHPTDVLITGFDIIFFWVARMIMFTMHFVKDENGKP
QVPFKTVYVTGLIRDEQGQKMSKSKGNVLDPIDMIDGISLEDLLEKRTGNMMQPQLAEKI
AKATRKEFAEGIAAHGTDALRFTLAALASNGRDINWDMKRLEGYRNFCNKLWNASRFVLT
NEKLDLSQGEIEFSLADRWIQSEFNRTVETFRNSLSQYRFDLCANAIYEFTWNQFCDWYL
ELTKPVFANGNAAQIRAASQTLVHVLEKLLRLAHPLIPFITEEIWQKVKGFVDITADSIM
LQPFPQVEENCFDPEAEAEIEWLKEVIVAVRNIRAESNIAPSKGLDLLFRNLSAENAKIL
EKQTALLKAMAKLDNVQVLAANETAPLAVAKLVGNAELLVPMAGFINKEAELARLTKEIE
KYQNEVKRIENKLSNEAFVAKAPEAVIAKEREKQAEYQSGLEKIQEQYKAIEAL
Download sequence
Identical sequences A0A1Q5Y1S2 A5UEN9
374931.CGSHiGG_00725 gi|148826875|ref|YP_001291628.1| WP_011962068.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]