SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 37692.ATP_00359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  37692.ATP_00359
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 2.22e-16
Family Ribosomal protein L30p/L7e 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 37692.ATP_00359
Sequence length 61
Comment (Candidatus Phytoplasma mali)
Sequence
MKKPQFIIILNKSLIARTKSQIQTAHILGLRKINQKVIKDDNPVNRGMIRKIYHLVTIEK
L
Download sequence
Identical sequences B3R009
gi|194246751|ref|YP_002004390.1| 37692.ATP_00359 WP_012504505.1.43358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]