SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 378753.KRH_09830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  378753.KRH_09830
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 4.84e-74
Family ATP synthase (F1-ATPase), gamma subunit 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 378753.KRH_09830
Sequence length 303
Comment (Kocuria rhizophila DC2201)
Sequence
MGAQIRVYRQKIASTSSMKKIFKAMEMIATSRINKSRQALEGAYPYANALTRAASQIATQ
HNISHPLTTVPDQVRRSAVMVFTSDRGLAGSYSSNVLKRTEELLELLRSQGKEARVYLVG
RKAKAYFDFRHREYDEFWTGNTDNASTERAEELTERLMHDISAPHEDGGVDEVLLVYTQF
KSMVTQEPRVLRLLPLEIADANDLGDDVSERFEDLREHASHFEFEPNPEEVFNEILPRYV
RARVYSALCHAASSELASRQRAMKAAGDNATELIKKYTRLMNNARQAEITTELTEIVSGA
EAL
Download sequence
Identical sequences B2GLY9
378753.KRH_09830 WP_012398051.1.5541 WP_012398051.1.84478 gi|184200629|ref|YP_001854836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]