SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 386585.ECs1028 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  386585.ECs1028
Domain Number 1 Region: 34-157
Classification Level Classification E-value
Superfamily PapD-like 2.38e-26
Family Pilus chaperone 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 386585.ECs1028
Sequence length 189
Comment (Escherichia coli O157H7)
Sequence
MPARHLYFIMTNTWNRLALLIFAVLSLLVAGELQAGVVVGGTRFIFPADRESISILLTNT
SQESWLINRKINRPTRWAGGEASTVPAPLLAAPPLILLKPGTTGTLRLLRTESDILPVDR
ETLFELSIASVPSGKVENQSVKVAMRSVFKLFWRPEGCRATRWKLINNYAGHGSRRVYNS
LTQRLITLT
Download sequence
Identical sequences A0A0F6C1E1 C3SDQ1 Q8XDB9
gi|387881555|ref|YP_006311857.1| gi|15830282|ref|NP_309055.1| NP_309055.1.58667 386585.ECs1028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]