SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 388396.VFMJ11_0223 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  388396.VFMJ11_0223
Domain Number 1 Region: 6-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-60
Family G proteins 0.0000000338
Further Details:      
 
Domain Number 2 Region: 302-394
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.99e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000411
Further Details:      
 
Domain Number 3 Region: 205-301
Classification Level Classification E-value
Superfamily Translation proteins 2.36e-29
Family Elongation factors 0.00000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 388396.VFMJ11_0223
Sequence length 394
Comment (Vibrio fischeri MJ11)
Sequence
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKIYGGVAKDFASIDNAPEERERG
ITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGILVVAATDGPMPQTREHI
LLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPVIQGSALGALN
GEKEWEDKIVELAEALDSYIPEPERAVDQPFLLPIEDVFSIQGRGTVVTGRIERGILRVG
DEVEIVGIKETTMTTCTGVEMFRKLLDEGRAGENVGALLRGTKRDDVERGQVLAAKGSIN
PHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDITLPEGVEMVMPGDNVQMT
VELIAPIAMDEGLRFAIREGGRTVGAGVVAKIFA
Download sequence
Identical sequences B5FC95 Q5E228
gi|197333959|ref|YP_002154994.1| gi|197335233|ref|YP_002157211.1| WP_005417220.1.44395 WP_005417220.1.62330 YP_203616.1.56684 YP_205806.1.56684 312309.VF_0233 312309.VF_2423 388396.VFMJ11_0223 388396.VFMJ11_2537 gi|59710840|ref|YP_203616.1| gi|59713030|ref|YP_205806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]