SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 390235.PputW619_0483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  390235.PputW619_0483
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.94e-40
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 390235.PputW619_0483
Sequence length 183
Comment (Pseudomonas putida W619)
Sequence
MQLRNSPSRYGVISIVLHWVVALAVFGLFGLGLWMVGLDYYSPWRKAGPDLHKSIGLVLL
AVMLVRVLWRLISPPPPAPANHGAFTRLAAKLGHLALYIGLFAVMVAGYLISTADGVGIP
VFGLFEVPALVSDLPDQADLAGVIHLWLAWGLVIFAVLHALAALKHHYIDRDATLVRMLG
RKA
Download sequence
Identical sequences B1J2Y2
gi|170719669|ref|YP_001747357.1| 390235.PputW619_0483 WP_012312425.1.83615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]